---
product_id: 25467835
title: "ChemTechBio Growth Hormone Releasing Factor, GRF (1 - 29), amide, human 2 mg"
brand: "chemtechbio"
price: "€ 222.71"
currency: EUR
in_stock: true
url: https://www.desertcart.pt/products/25467835-chemtechbio-growth-hormone-releasing-factor-grf-1-29-amide-human
store_origin: PT
region: Portugal
---

# ChemTechBio Growth Hormone Releasing Factor, GRF (1 - 29), amide, human 2 mg

**Brand:** chemtechbio
**Price:** € 222.71
**Availability:** ✅ In Stock

## Quick Answers

- **What is this?** ChemTechBio Growth Hormone Releasing Factor, GRF (1 - 29), amide, human 2 mg by chemtechbio
- **How much does it cost?** € 222.71 with free shipping
- **Is it available?** Yes, in stock and ready to ship
- **Where can I buy it?** [www.desertcart.pt](https://www.desertcart.pt/products/25467835-chemtechbio-growth-hormone-releasing-factor-grf-1-29-amide-human)

## Best For

- chemtechbio enthusiasts

## Why This Product

- Trusted chemtechbio brand quality
- Free international shipping included
- Worldwide delivery with tracking
- 15-day hassle-free returns

## Description

Product Information Product Name Growth Hormone Releasing Factor, GRF (1 - 29), amide, human Purity % Peak Area By HPLC â‰¥ 95% Molecular Weight 3357.9 Storage -20Â°C Sequence(One-Letter Code) YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 Sequence(Three-Letter Code) H - Tyr - Ala - Asp - Ala - Ile - Phe - Thr - Asn - Ser - Tyr - Arg - Lys - Val - Leu - Gly - Gln - Leu - Ser - Ala - Arg - Lys - Leu - Leu - Gln - Asp - Ile - Met - Ser - Arg - NH2 Description This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. References Ref: Ling, N. et al. Proc. Natl. Acad. Sci. USA 81, 4302 (1984); Gaudreau, P. et al. J. Med. Chem. 35, 1864 (1992); Zarandi, VA. et al. Biochem. Biophys. Res. Commun. 119, 265 (1984); Lapierre, H. et al. Domest. Anim. Endocrinol. 4, 207 (1987); Mayo, KE. et al. Nature 306, 86 (1983); Pinski, J. et al. Peptide Protein Res. 41, 707 (1993).

## Features

- ChemTechBio Growth Hormone Releasing Factor, GRF (1 - 29), amide, human 2 mg

## Images

![ChemTechBio Growth Hormone Releasing Factor, GRF (1 - 29), amide, human 2 mg - Image 1](http://ecx.images-amazon.com/images/I/116PIpsGs4L.jpg)

---

## Why Shop on Desertcart?

- 🛒 **Trusted by 1.3+ Million Shoppers** — Serving international shoppers since 2016
- 🌍 **Shop Globally** — Access 737+ million products across 21 categories
- 💰 **No Hidden Fees** — All customs, duties, and taxes included in the price
- 🔄 **15-Day Free Returns** — Hassle-free returns (30 days for PRO members)
- 🔒 **Secure Payments** — Trusted payment options with buyer protection
- ⭐ **TrustPilot Rated 4.5/5** — Based on 8,000+ happy customer reviews

**Shop now:** [https://www.desertcart.pt/products/25467835-chemtechbio-growth-hormone-releasing-factor-grf-1-29-amide-human](https://www.desertcart.pt/products/25467835-chemtechbio-growth-hormone-releasing-factor-grf-1-29-amide-human)

---

*Product available on Desertcart Portugal*
*Store origin: PT*
*Last updated: 2026-06-21*